PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01951.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 1648aa    MW: 180701 Da    PI: 6.7673
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01951.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-11858899346
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +WT+eE e+++   +++G++ +k+Ia+++   +t  +c+++++k
  Rsa1.0_01951.1_g00008.1 858 PWTPEEKEIFLSMLAMHGKD-FKKIASYLT-QKTTADCIDYYYK 899
                              8*****************99.********9.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.03E-15841902IPR009057Homeodomain-like
PROSITE profilePS5129315.184854905IPR017884SANT domain
SMARTSM007172.1E-10855903IPR001005SANT/Myb domain
PfamPF002496.2E-10857899IPR001005SANT/Myb domain
CDDcd001671.09E-8858900No hitNo description
Gene3DG3DSA:1.10.10.609.7E-8858904IPR009057Homeodomain-like
PROSITE profilePS5129311.30710671118IPR017884SANT domain
SMARTSM007171.0E-510681116IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-810711118IPR009057Homeodomain-like
CDDcd001672.81E-510721113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1648 aa     Download sequence    Send to blast
MPPQDHSSWD RKDLLRQRKH ERPSEPPFDP PPFRWRDSSS SSSSHRDFNS RWGGSSDFRR  60
PSSCKIPYLI IFSLIIDHGK QGGRYPFAEE SSHGYTSSRS SARMFENDYY RPSAPRGDWR  120
YTRNCRDDRV PLNNKDWRCN TWEMNNGSSR AFERPCGVRN GRRSVEDRPP ASDSHTSVVN  180
SWEPSNSAQQ MDIELCTPVR TVRFKNEQKF SDQRQSLPSD PHADGPGLFD RPSSVNSYEN  240
KECSPAKQTN GLMYGRRLAD DNPPVLNAEI EGTRNQILLK EDNKLHGVSD LDGVRENGKE  300
NSLGATGKLP VWTRSGSFAS QSSGFSHSSS LKSLGAVDSS DRELKILPKT VAVTQSSSGD  360
ATACAKTTLS EEMSSRKKQR LGWGEGLAKY ENKKVDVNTT EDGTDLLENS AEELHSLNKS  420
IADKSPTAAN APDYGSPTTP SSVACNSSPD KSSAKGAIGA SDVSNMCLSP SPVSSIHLER  480
LPINIEELDN ISMERVGCLL KELLGTDDPG TGDSSSVQLT SMNKLLAWKG DILKAVEMAE  540
SEIDLLESKQ RALKLESGRQ CRVVKHASEG DENVQQEASC NLGLKAVASS VAETLVRDPV  600
HQAAKVPSEI IEDSCREVNS LCHFLATVGS NEDILPIPST KADANQETID LSSADDSMVS  660
DEKLLGAKLL STNKTYACES SQVFNKMLPR DFSSFDYSRF PGICQRQFDS HVKEKIADRI  720
ELLRAREKIL LLQFKAFQLA WKKDVRQLAS AKYQPKANKR TEVFPYAKNG GHLKFSQPVR  780
LRLSSSASRR DSVASTTELV GYMKKLLKNT RLKPFRDILR MPAMILDEKE RVRSRFISSN  840
GLIEDPCDVE KERTMINPWT PEEKEIFLSM LAMHGKDFKK IASYLTQKTT ADCIDYYYKN  900
HKSDCFGKIK KQRGYGKEGK HTYMLAPTKK WKREMGAASL DILGAVSIIA ANAGKASTRQ  960
TSSKRITLRG CSSSSSLQRD GNYSEGYSHS FDFPRKRTLG ADVVAVGPLS SEQINSCLRT  1020
SVNSREGCMD HLKFAPAAKK PRISHTTHNE NSNEDDDSCS DESCGETGPI HWTDAERSAF  1080
IQGFSQFGKN FASLSRFVRT RSPDQCRVFF SKVRKCLGLE CIQSGSGNVS TSASVDNAIE  1140
GGGSDLEGPC ATESNSGICN NGVSATIGLD THTSPVNMNQ ERANHSGFEN VEAGLSRSEQ  1200
ENGLALLRLK DVTNLVDAAS IPGQVSEPCR DLVDINTVES SHCQAADQIN SNDLLSKEIN  1260
EGNSTSVAAE ETKSSDQLST EIDEGNLTPV AVSSDPLYCG SLVLPNNIVE KGSGCEGAAL  1320
PNQSSKMQDG VMQAANRTIN SGLEAEAAPS SFRYLECLHH VPIEEDLVGV VSVPQGDSNC  1380
HTESELPNPL VVQTNKMGWQ FSEVNLDLER GSQVLGHIKA EQNGQLNATS TDSCQIPWIS  1440
FTQDPSRIIR SKSDLIVKAQ RTGEAFSLRK CTSSATKPLT VFQKDGRSGH SRSHSFSLSN  1500
TERLDKNGDV KLFGTVLTAD ENGSKQKHNP GGSIRSSSTL SRDHETGNQY INQQHLQNVP  1560
ITSYGFWDGN RIQTGLTSLP ESAKLLASYP EALTTHLEQQ VVSTKDIQLD ASGVLSFGKH  1620
IEDRAEVSSG KDKGKIGGEI TGVAEAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D2e-16816906493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C2e-16816906493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013663146.10.0PREDICTED: uncharacterized protein LOC106367835
TrEMBLA0A0D3DS760.0A0A0D3DS76_BRAOL; Uncharacterized protein
STRINGBra006915.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein